Research library / Compounds

What is ?

All 44 amino acids of human GHRH, plus one small chemical cap.

is a synthetic analogue of human growth hormone-releasing hormone (GHRH), the 44-amino-acid peptide that signals the pituitary to release growth hormone. It keeps the full GHRH sequence and adds a small chemical group to the start of the chain. Prism Labs supplies it as a 10 mg lyophilized vial.

Prism Labs editorial · Updated October 8, 2026 · 3 min read

Lyophilized vial10mg · 99.75% purity$64.99View product

What it is

Its chain is the 44 residues of human GHRH, YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, ending in an amide. On the first residue sits a trans-3-hexenoyl group, a six-carbon chain that sets it apart from the natural hormone.

The reference record lists the formula C221H366N72O67S and a molecular weight of about 5,136 g/mol (PubChem CID 16137828).

Sources: [1] PubChem · reference structure · [2] Science · 1982

Where it came from

GHRH itself was found in 1982, when two groups isolated it from pancreatic tumors that had caused acromegaly, a condition of excess growth hormone. Roger Guillemin’s group published the 44-residue sequence and showed the synthetic peptide was fully active.

The natural hormone acts only briefly, which is why chemists designed modified versions. This analogue has an extensive clinical literature, summarized in reviews from 2011 and 2012.

Sources: [2] Science · 1982 · [3] Nature · 1982 · [7] Journal of Clinical Endocrinology & Metabolism · 2006 · [4] Drugs · 2011 · [5] Annals of Pharmacotherapy · 2012

Lyophilized vial from Prism Labs — Every lot ships with its own certificate of analysis.

How it compares with other GHRH analogues

Several synthetic analogues are built on GHRH. A 2021 anti-doping study examined four of them together:

: the first 29 amino acids of GHRH.
: a modified 29-residue version, made with or without a DAC group that binds it to albumin.
: all 44 residues, with the hexenoyl group added.

The 44-residue and 29-residue analogues side by side: vs , compared. The shorter one on its own: What is ?

For the side of the family, see What is / ?

Sources: [6] Drug Testing and Analysis · 2021

What researchers have studied

Its literature spans the growth hormone axis and analytical chemistry:

Growth hormone and IGF-1 secretion, the axis GHRH controls.
Lipid-metabolism research in clinical studies, reviewed in 2011 and 2012.
Detection methods: a 2021 anti-doping study identified its metabolites.

These are observations in laboratory models. They are not evidence about any use in people.

Sources: [4] Drugs · 2011 · [5] Annals of Pharmacotherapy · 2012 · [6] Drug Testing and Analysis · 2021

How it is supplied and stored

ships as a lyophilized (freeze-dried) powder in 10 mg vials. The powder is stable at room temperature in transit. For lab use it is reconstituted with bacteriostatic water such as .

Concentration is content divided by volume: 10 mg in 2 mL gives 5 mg per mL. The reconstitution calculator handles other combinations.

For storage before and after reconstitution, see how to store lyophilized peptides.

How to verify a batch

Every lot has its own certificate of analysis from an independent lab. Read three results separately:

Identity: confirms the expected compound was detected.
Purity: the share of the measured material that is the intended compound.
Content: the amount measured, compared with the label.

Then match the lot number on your vial or bottle to the report, and use the report’s verification link to confirm it with the testing lab. Step by step: how to read a peptide COA.